Product Name: Pancreatic Polypeptide (human)
CAS No: 75976-10-2
Purity: 95%
Molar Mass: 4181.7
Chemical Formula: C185H287N53O54S2
Storage: Store at -20℃
Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY
Application: Pancreatic Polypeptide (PP) is a peptide hormone secreted by the PP cells (F cells) of the pancreas in response to food intake. It regulates pancreatic enzyme secretion and gastrointestinal motility by binding to specific receptors in the brain and digestive organs. PP plays a critical role in maintaining energy balance and modulating appetite by influencing the hypothalamus. Its levels are altered in various conditions, including obesity, anorexia, and pancreatic disorders. Due to its regulatory functions, Pancreatic Polypeptide is a valuable biomarker in metabolic research and offers potential therapeutic applications in treating metabolic and eating disorders.
