Product Name: Obtustatin
CAS No: 404882-00-4
Purity: 95%
Molar Mass: 4393.1
Chemical Formula: C184H284N52O57S8
Storage: Store at -20℃
Sequence: CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG
Target: integrin α1β1
Application: Obtustatin is a disintegrin protein derived from Vipera lebetina venom, known for its ability to selectively inhibit α1β1 integrin receptors. This interaction prevents integrin-mediated cell adhesion and migration, particularly in endothelial and smooth muscle cells. Obtustatin is primarily studied for its potential therapeutic applications in inhibiting angiogenesis, the formation of new blood vessels crucial in tumor growth and metastasis. Its specificity and potency in targeting α1β1 integrin make it a valuable tool in cancer research and the development of anti-angiogenic therapies.