Product Name: Neuropeptide Y (human, rat)
CAS No: 90880-35-6
Purity: 95%
Molar Mass: 4271.7
Chemical Formula: C189H285N55O57S
Storage: Store at -20℃
Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Application: Neuropeptide Y (NPY) is a highly conserved peptide neurotransmitter that plays a critical role in regulating various physiological processes, including appetite, circadian rhythms, and stress response. It exerts its effects by binding to Y receptors in the brain, modulating neurotransmitter release, and influencing energy balance. NPY is involved in promoting food intake, reducing anxiety, and enhancing memory retention. Its dysregulation has been linked to conditions such as obesity, anxiety disorders, and hypertension. Due to its broad physiological impact, NPY is a significant target for research in neurobiology, metabolic disorders, and psychiatric conditions.
Reference: Gehlert, D. R. (2004). Introduction to the reviews on neuropeptide Y. Neuropeptides, 38(4), 135-140.