Product Name: Guangxitoxin 1E
CAS No: 1233152-82-3
Purity: 95%
Molar Mass: 3948.6
Chemical Formula: C178H248N44O45S7
Storage: Store at -20℃
Sequence: EGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP
Target: KV2.1 and KV2.2 channels
Application: Guangxitoxin 1E is a peptide toxin derived from the venom of the Chinese tarantula, Plesiophrictus guangxiensis. It acts as a potent inhibitor of voltage-gated potassium channels (Kv2.1), affecting neuronal excitability and synaptic transmission. By blocking these channels, Guangxitoxin 1E can modulate action potential duration and neurotransmitter release, making it a valuable tool in neurophysiological studies. This peptide is useful in research focused on understanding potassium channel functions, neurodegenerative diseases, and the development of new therapeutic strategies for conditions like epilepsy and chronic pain. Its specific action on Kv2.1 channels highlights its importance in both basic and applied neuroscience.