Product Name: GLP-1(7-37)
CAS No: 106612-94-6
Purity: 95%
Molar Mass: 3355.7
Chemical Formula: C151H228N40O47
Synonyms: Glucagon-related peptide 1 (Rana catesbeiana), 3-L-glutamic acid-10-L-valine-16-glycine-17-L-glutamine-23-L-isoleucine-24-L-alanine-27-L-valine-31-glycine-32-de-L-lysine- (ZCI)
Storage: Store at -20℃
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Application: GLP-1(7-37) is a potent incretin hormone essential for glucose homeostasis and appetite regulation. It binds to the GLP-1 receptor, stimulating insulin secretion and inhibiting glucagon release in a glucose-dependent manner. This peptide also slows gastric emptying and promotes satiety, making it a valuable therapeutic agent for type 2 diabetes and obesity management. Additionally, GLP-1(7-37) exhibits cardioprotective and neuroprotective effects, contributing to its potential in treating cardiovascular diseases and neurodegenerative disorders. Its multifaceted mechanism of action and therapeutic versatility make GLP-1(7-37) a critical component in advanced metabolic and pharmacological research.
