Brimapitide

Product Name: Brimapitide

CAS No: 1445179-97-4

Purity: 95%

Molar Mass: 3822.44

Chemical Formula: C164H286N66O40

Synonyms: XG-102, AM-111

Storage: Store at -20℃

Sequence: DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG

Target: JNK

Application: Brimapitide (CAS: 1445179-97-4) is a synthetic peptide-based drug currently under investigation for its potential therapeutic applications in conditions related to the gastrointestinal system, particularly in the treatment of gastrointestinal disorders such as inflammatory bowel disease (IBD). Brimapitide functions by targeting specific receptors or pathways involved in the regulation of gastrointestinal inflammation and immune responses. It is designed to modulate these pathways to alleviate symptoms associated with IBD, such as abdominal pain, diarrhea, and mucosal inflammation. In pharmaceutical chemistry, brimapitide’s targeted approach to addressing gastrointestinal inflammation represents a promising avenue for the development of novel therapies for IBD and other related conditions. Clinical trials are underway to evaluate its safety, efficacy, and therapeutic potential in patients with IBD, with the aim of providing new treatment options for individuals affected by these debilitating diseases.

Reference:

Taubert, E., van der Aa, F., & Heesakkers, J. (2024). Bladder pain syndrome AKA interstitial cystitis–a condition with severe unmet medical need: an exploration of brimapitide as a potential treatment opportunity. Current Opinion in Urology, 34(2), 52-57.

Porte, B., Marguerit, G., Thomasseau, S., Paquet, C., & Hugon, J. (2020). Dose-dependent neuroprotective effect of the JNK inhibitor Brimapitide in 5xFAD transgenic mice. Brain Research, 1727, 146587.