Bay 55-9837

Product Name: Bay 55-9837

CAS No: 463930-25-8

Molar Mass: 3742.3

Chemical Formula: C167H270N52O46

Storage: Store at -20℃

Sequence: HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY

Target: VPAC2

Purity: 95%

Application: BAY 55-9837 is a synthetic peptide that acts as a selective agonist for the glucagon-like peptide-1 (GLP-1) receptor. It mimics the action of endogenous GLP-1, stimulating insulin secretion in a glucose-dependent manner while inhibiting glucagon release. This peptide also slows gastric emptying and promotes satiety, contributing to its potential in managing type 2 diabetes and obesity. By enhancing insulin sensitivity and preserving β-cell function, BAY 55-9837 offers therapeutic benefits for glucose control and metabolic health. Its targeted mechanism of action makes it a valuable candidate for diabetes research and potential clinical applications in metabolic disorders.

Reference: Hadwen, J., MacKenzie, D., Shamim, F., Mongeon, K., Holcik, M., MacKenzie, A., & Farooq, F. (2014). VPAC2 receptor agonist BAY 55-9837 increases SMN protein levels and moderates disease phenotype in severe spinal muscular atrophy mouse models. Orphanet Journal of Rare Diseases, 9, 1-9.