Product Name: Mambalgin 1
CAS No: 1609937-15-6
Purity: 95%
Molar Mass: 6554.5
Chemical Formula: C272H429N85O84S10
Storage: Store at -20℃
Sequence: LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK
Application: Mambalgin 1 is a peptide derived from the venom of the black mamba snake (Dendroaspis polylepis), known for its potent analgesic properties. It acts as a selective antagonist of acid-sensing ion channels (ASICs), particularly ASIC1a and ASIC2a, which are involved in pain perception. By blocking these channels, Mambalgin 1 effectively inhibits pain signaling pathways without causing the side effects associated with opioid analgesics. This peptide shows significant promise in the treatment of chronic pain and inflammatory pain conditions. Its unique mechanism of action positions it as a valuable tool in pain research and the development of novel, non-opioid pain therapeutics.