Product Name: Bay 55-9837
CAS No: 463930-25-8
Molar Mass: 3742.3
Chemical Formula: C167H270N52O46
Storage: Store at -20℃
Sequence: HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY
Target: VPAC2
Purity: 95%
Application: BAY 55-9837 is a synthetic peptide that acts as a selective agonist for the glucagon-like peptide-1 (GLP-1) receptor. It mimics the action of endogenous GLP-1, stimulating insulin secretion in a glucose-dependent manner while inhibiting glucagon release. This peptide also slows gastric emptying and promotes satiety, contributing to its potential in managing type 2 diabetes and obesity. By enhancing insulin sensitivity and preserving β-cell function, BAY 55-9837 offers therapeutic benefits for glucose control and metabolic health. Its targeted mechanism of action makes it a valuable candidate for diabetes research and potential clinical applications in metabolic disorders.