Product Name: Ularitide
CAS No: 118812-69-4
Purity: 95%
Molar Mass: 3505.96
Chemical Formula: C145H234N52O44S3
Synonyms: Urodilatin
Storage: Store at -20℃
Sequence: TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
Target: renal receptors
Application: Ularitide (CAS: 118812-69-4) is a synthetic form of urodilatin, a natriuretic peptide primarily synthesized in the kidney. It functions as a vasodilator and natriuretic hormone, playing a key role in regulating blood pressure and fluid balance in the body. Ularitide acts by stimulating guanylate cyclase receptors in the vascular smooth muscle and renal tubules, leading to increased cyclic guanosine monophosphate (cGMP) levels, which in turn promote vasodilation and natriuresis (excretion of sodium in urine). Due to its potent vasodilatory and diuretic effects, ularitide is being investigated for its potential therapeutic applications in conditions such as acute decompensated heart failure (ADHF). Clinical trials have shown promising results, demonstrating ularitide’s ability to improve hemodynamic parameters, relieve symptoms, and reduce hospitalizations in patients with ADHF. Despite these positive findings, further research is needed to fully elucidate ularitide’s mechanisms of action and optimize its clinical use in heart failure management.
Reference: