Product Name: Cagrilintide
CAS No: 1415456-99-3
Purity: 95%
Molar Mass: 4409.01
Chemical Formula: C194H312N54O59S2
Synonyms: GLXC-26801
Storage: Store at -20℃
Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Target: CTR
Application: Cagrilintide (CAS: 1415456-99-3) is a synthetic peptide drug that acts as a dual agonist of the glucagon-like peptide-1 (GLP-1) and glucagon receptors. It is primarily used in the management of type 2 diabetes mellitus to regulate blood glucose levels. Cagrilintide stimulates GLP-1 receptors, leading to increased insulin secretion, decreased glucagon secretion, slowed gastric emptying, and reduced appetite. Additionally, its agonism of glucagon receptors contributes to glucose-dependent insulin secretion and hepatic glycogenolysis inhibition. This dual action helps to improve glycemic control and promote weight loss in patients with type 2 diabetes. In pharmaceutical chemistry, cagrilintide’s unique mechanism of action represents a significant advancement in diabetes therapy, offering a targeted approach to addressing multiple aspects of glucose metabolism and appetite regulation. Ongoing research continues to explore its potential in diabetes management and its role in combination therapies, highlighting its versatility in the treatment of metabolic disorders.
Reference: