Product Name: Brimapitide
CAS No: 1445179-97-4
Purity: 95%
Molar Mass: 3822.44
Chemical Formula: C164H286N66O40
Synonyms: XG-102, AM-111
Storage: Store at -20℃
Sequence: DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG
Target: JNK
Application: Brimapitide (CAS: 1445179-97-4) is a synthetic peptide-based drug currently under investigation for its potential therapeutic applications in conditions related to the gastrointestinal system, particularly in the treatment of gastrointestinal disorders such as inflammatory bowel disease (IBD). Brimapitide functions by targeting specific receptors or pathways involved in the regulation of gastrointestinal inflammation and immune responses. It is designed to modulate these pathways to alleviate symptoms associated with IBD, such as abdominal pain, diarrhea, and mucosal inflammation. In pharmaceutical chemistry, brimapitide’s targeted approach to addressing gastrointestinal inflammation represents a promising avenue for the development of novel therapies for IBD and other related conditions. Clinical trials are underway to evaluate its safety, efficacy, and therapeutic potential in patients with IBD, with the aim of providing new treatment options for individuals affected by these debilitating diseases.
Reference: